PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Manes.11G082400.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
Family TALE
Protein Properties Length: 679aa    MW: 74051.1 Da    PI: 6.5124
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Manes.11G082400.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox28.32.9e-094164531954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+ +++  LA+++gLt +qV++WF N R +
  Manes.11G082400.1.p 416 FEHflHPYPKDSDKIMLARQTGLTRSQVSNWFINARVR 453
                          664459******************************88 PP

2BELL127.83.8e-41278349172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqelq+k +kLls+l+eVd+rYkqy++q+q+v+ssF+++ag+g+akpY +lAl++iSrhFrcL+dai++qi
  Manes.11G082400.1.p 278 ERQELQNKLSKLLSMLDEVDRRYKQYYHQMQIVVSSFDVIAGCGAAKPYSALALQTISRHFRCLRDAISGQI 349
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005743.8E-68204347IPR006563POX domain
PfamPF075262.8E-52210346IPR006563POX domain
PROSITE profilePS5007112.163394457IPR001356Homeobox domain
CDDcd000864.44E-13397458No hitNo description
SMARTSM003891.0E-9397461IPR001356Homeobox domain
SuperFamilySSF466892.52E-17398464IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.1E-29400463IPR009057Homeodomain-like
PfamPF059204.6E-18414453IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 679 aa     Download sequence    Send to blast
MATYYAGSNN QRDAAPMIYM PGSYSETPVL PGNMMMYMNG GGSYSDALAG NSHQQNNSIQ  60
IHSVEAPDST PQQQEILSNL SGSRIGEHDF NAWRDSRNEM LVMHSMGGPS GIIHSGHNLQ  120
GQGLSLSLGT QIPSGIQMHS IPYRNSNPGL ASFLGPNPSI MGEGSGRNGS SRDEQTKSAE  180
YLPPGFSGGN QDSNKGDLSP YGMNSIARTI PNSKYLKAAQ QLLDEVVNVR KALKQPDKEK  240
NQSTNEHGLN SPKGGDSKSK NGSADPQEST NSELSHAERQ ELQNKLSKLL SMLDEVDRRY  300
KQYYHQMQIV VSSFDVIAGC GAAKPYSALA LQTISRHFRC LRDAISGQIQ ATRKSLGDQE  360
TSENGKGIGI TRLRYVDQQL RQQRALQQLG MMQQHAWRPQ RGLPESSVSI LRAWLFEHFL  420
HPYPKDSDKI MLARQTGLTR SQVSNWFINA RVRLWKPMVE EMYKEEIGDV EMDSNSSSEN  480
ATKATKGDLR NYKDGGEDMQ QSASSTATER CSAVQLLDSK SDHVPHVEMG GSTARSNFQN  540
MMRSEAVTEY GLLKLREEQR PSVDDCGLFP DAIVHSDGSG DRFMAAAAAA YQMSEVGGFG  600
TGSGVSLTLG LQHCEGGNLP MSSATHHSFV SMRGDDDIYG AAAAASSVGA ENTDFECLNP  660
GNRQNRFSSS HLLHDFVA*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_A5e-17403460158Homeobox protein Meis1
4xrs_B5e-17403460158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012067209.10.0PREDICTED: BEL1-like homeodomain protein 6
SwissprotO656851e-144BLH6_ARATH; BEL1-like homeodomain protein 6
TrEMBLA0A067LCG10.0A0A067LCG1_JATCU; Uncharacterized protein
STRINGPOPTR_0004s16660.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF21463179
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.21e-127BEL1-like homeodomain 6